top of page

CircRNA

Gene

chr2|160300650|160303487|—|2|circRNA|RBMS1|ENST00000474820.5|7,6

RBMS1

Open Reading Frame (ORF)

MESTEKCEAVIGHFNGKFIKTPPGVSATGTRSYQPLHF

Peptide

TPPGVSATGTR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page