top of page

CircRNA

Gene

chr2|159967538|159987358|-|9|circRNA|PLA2R1|ENST00000283243.11|20,19,18,17,16,15,14,13,12

PLA2R1

Open Reading Frame (ORF)

MERVPKDGYILTIRLQWWLCCHARKASTWSLGSEALSAL

Peptide

ASTWSLGSEALSAL

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page