top of page

CircRNA

Gene

chr2|159777937|159783469|—|3|circRNA|CD302|NM_001198763|4,3,2

CD302

Open Reading Frame (ORF)

LSFIYLDSVPRQLLHFSPRSHQSRKHRGCQKSVY

Peptide

QLLHFSPR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page