top of page

CircRNA

Gene

chr2|144141881|144235737|-|5|circRNA|GTDC1|ENST00000409214.5|6,5,4,3,2

GTDC1

CircRNA UID

circGTDC1(6,5,4,3,2)

Open Reading Frame (ORF)

LVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRYLCISQIGHM

Peptide

FPDVSRYLCISQIGHM

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page