top of page

CircRNA

Gene

chr2|135803929|135812956|—|5|circRNA|LCT|ENST00000264162.6|11,10,9,8,7

LCT

Open Reading Frame (ORF)

LLIFWVCRITPPASSATPHKTPASLAMIPLEASPNT

Peptide

LLIFWVCR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page