top of page

CircRNA

Gene

chr2|134942611|134946465|+|3|circRNA|CCNT2|ENST00000419781.5|5,6,7

CCNT2

Open Reading Frame (ORF)

MCLLPLLRQETGPSTVVVPSCLLCGVLYKGLWAQRG

Peptide

MCLLPLLR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page