top of page

CircRNA

Gene

chr2|127949868|127978089|-|4|circRNA|SAP130|ENST00000357702.9|18,17,16,15

SAP130

CircRNA UID

circSAP130(18,17,16,15)

Open Reading Frame (ORF)

MSQCVQDPPLLCFVTIGTPGKLLTTTFRGTVTSGSKNGSSENPHSSSAS

Peptide

GTVTSGSKNGSSENPHSSSAS

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

13

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page