top of page

CircRNA

Gene

chr2|121605700|121606180|-|1|circRNA|CLASP1|ENST00000263710.8|2

CLASP1

Open Reading Frame (ORF)

LLGGSHRDCPLAFAGSGFEFHYGASHGVLPGAGVAEGCGETIAGWPRTDRLFLRQTEVC

Peptide

LLGGSHR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

TRUE

Peptide Exists in PepTransDB

false

bottom of page