top of page

CircRNA

Gene

chr2|121407470|121410969|-|2|circRNA|CLASP1|ENST00000263710.8|25,24

CLASP1

CircRNA UID

circCLASP1(25,24)

Open Reading Frame (ORF)

LVRKERRASGPAELTEEPKNTEIGLGLASQEEYLVL

Peptide

NTEIGLGLASQEEYLVL

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page