top of page

CircRNA

Gene

chr2|11556453|11566656|+|3|circRNA|GREB1|NM_014668|2,3,4

GREB1

Open Reading Frame (ORF)

LSPFPTSPWMSLRAFSSWGSSPPACRTISWCAPLTRGSCQMTMATMLFL

Peptide

TISWCAPLTRGSCQMTMATMLFL

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page