top of page

CircRNA

Gene

chr2|113182345|113183512|+|1|circRNA|PSD4|ENST00000245796.10|2

PSD4

Open Reading Frame (ORF)

LGLRCGAHTPGEPLCPEGAQAEHSITRVTSEQPSTGEPKAEPEHVHTGSVLGRHPAGPDVCPRPGGGAGEDGRAQGWAEMLSPHAPCGPPRGHGPALQPT

Peptide

AQGWAEMLSPHAPCGPPR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page