top of page

CircRNA

Gene

chr2|112086104|112089607|+|1|ciRNA|TMEM87B|ENST00000283206.8|9

TMEM87B

CircRNA UID

ciTMEM87B(9)

Open Reading Frame (ORF)

LLALLFWLRAGDQKGGHGLPSPHVLLFLCPSHETSELSLKRQTSGRIKLDFSVALRSWHLPS

Peptide

LDFSVALR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page