top of page

CircRNA

Gene

chr2|111872629|111880849|—|5|circRNA|ANAPC1|NM_022662|6,5,4,3,2

ANAPC1

Open Reading Frame (ORF)

LLFERSASSHEVPPGSPRNNVDIWNPCRTSMKKGQR

Peptide

NNVDIWNPCRTSMK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page