top of page

CircRNA

Gene

chr2|102683260|102684336|+|2|circRNA|SLC9A2|NM_003048|4,5

SLC9A2

CircRNA UID

circSLC9A2(4,5)

Open Reading Frame (ORF)

LFCVSVSPSCCCVSSEKIVYYGCHCCHILYCLHSESLLVQ

Peptide

IVYYGCHCCHILYCLHSESLLVQ

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page