top of page

CircRNA

Gene

chr2|102657563|102684336|+|4|circRNA|SLC9A2|NM_003048|2,3,4,5

SLC9A2

CircRNA UID

circSLC9A2(2,3,4,5)

Open Reading Frame (ORF)

LLLCFLGKNCLLRLPLLSYSLLSSFWLPSVSQVAHNSA

Peptide

LLLCFLGK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page