top of page

CircRNA

Gene

chr2|100006631|100011571|-|4|circRNA|AFF3|NM_001025108|6,5,4,3

AFF3

Open Reading Frame (ORF)

LEMVLADSSLGPNKCAMWRWAFRPRRGHLPWRPSTAAADTVFRTFLHP

Peptide

RGHLPWRPSTAAADTVFR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page