top of page

CircRNA

Gene

chr19|7444203|7444454|+|1|circRNA|CTD-2207O23.3|ENST00000593531.5|7

CTD-2207O23.3

CircRNA UID

circCTD-2207O23.3(7)

Open Reading Frame (ORF)

LAASSHALTTCWRRTATSSLGSRSAARSPWRRAVTGIMSSRKSATSWFSRADADRGAPRADAQDHAEGVLQGPAGGAAVQQQGHWPPLPMR

Peptide

AVTGIMSSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page