top of page

CircRNA

Gene

chr19|57397174|57398429|+|1|ciRNA|AC003002.6|ENST00000596617.5|3

AC003002.6

CircRNA UID

ciAC003002.6(3)

Open Reading Frame (ORF)

MELLPPTRVNMHFSSISVLTGKALTLAQCPGLGCVTPFYPKAALRFPQ

Peptide

MELLPPTRVNMHFSSISVLTGK

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page