top of page

CircRNA

Gene

chr19|5707059|5712002|-|4|circRNA|LONP1|NM_001276479|8,7,6,5

LONP1

CircRNA UID

circLONP1(8,7,6,5)

Open Reading Frame (ORF)

LYKALSLLKKEFELSKLQQRLGRESPYQQTAGGGARGAGGGEQAQAPQEVKAGQEGGGGRAERQAPGGAGDGAHP

Peptide

AGQEGGGGR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page