top of page

CircRNA

Gene

chr19|48985460|48986035|-|2|circRNA|GYS1|ENST00000323798.7|5,4

GYS1

CircRNA UID

circGYS1(5,4)

Open Reading Frame (ORF)

LHGKGGSPLRSRLHYCVPDHRHRGTALAQEETSSWHRVRRSHMWLLTSMSGWQALDSACVVPGDCL

Peptide

HRGTALAQEETSSWHR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page