top of page

CircRNA

Gene

chr19|48974212|48986035|-|9|circRNA|GYS1|ENST00000323798.7|12,11,10,9,8,7,6,5,4

GYS1

CircRNA UID

circGYS1(12,11,10,9,8,7,6,5,4)

Open Reading Frame (ORF)

LGLHTGSWHRVRRSHMWLLTSMSGWQALDSACVVPGDCL

Peptide

SHMWLLTSMSGWQALDSACVVPGDCL

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page