top of page

CircRNA

Gene

chr19|45258988|45263367|+|3|circRNA|MARK4|ENST00000587566.5|2,3,4

MARK4

CircRNA UID

circMARK4(2,3,4)

Open Reading Frame (ORF)

MAPWAVAAPRTKARPGPAAHWVPVAGTPSPPVPRSSPTWATTAC

Peptide

ARPGPAAHWVPVAGTPSPPVPRSSPTWATTAC

ORF Found in Long-Read

false

Peptide Length

32

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page