top of page

CircRNA

Gene

chr19|4405911|4409759|+|2|circRNA|CHAF1A|ENST00000301280.9|2,3

CHAF1A

Open Reading Frame (ORF)

LERPFQTFLAKQRRRVLAVEVQGGEATPRNVRHGAARS

Peptide

RVLAVEVQGGEATPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page