top of page

CircRNA

Gene

chr19|42343476|42348472|+|5|circRNA|MEGF8|ENST00000378073.5|9,10,11,12,13

MEGF8

Open Reading Frame (ORF)

MCPWSTVASSTQCCLEGQVDQGLRTWPCGRGPSAYTSWPGWPVALTRRTWPSSASQWSVLTCSCGAWWQRPVGGWGVQRPAPWGLDGVQGAPLCVPGTCP

Peptide

GPSAYTSWPGWPVALTRR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page