top of page

CircRNA

Gene

chr19|40255157|40265351|-|3|circRNA|AKT2|ENST00000392038.6|4,3,2

AKT2

CircRNA UID

circAKT2(4,3,2)

Open Reading Frame (ORF)

MPADEDREAATQHLCHTLPAVDHSHREDLPRGFSRRETVPCPRCLLHVLLP

Peptide

RETVPCPR

ORF Found in Long-Read

true

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page