top of page

CircRNA

Gene

chr19|38806460|38808948|—|2|circRNA|LGALS4|NM_006149|4,3

LGALS4

Open Reading Frame (ORF)

LWLGRIRAQTSPSTSIRGLTAGTRWSSTRCRAGSGAARRGRGACPSKRVPPLSWSS

Peptide

AGSGAARR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page