top of page

CircRNA

Gene

chr19|3647409|3648624|-|1|ciRNA|PIP5K1C|NM_001195733|9

PIP5K1C

CircRNA UID

ciPIP5K1C(9)

Open Reading Frame (ORF)

MGLADVSCVGARVCSPTGGRPGSAVPQVGARVCSPTGGRPGLQPHRWAPGSAVPQVDGRPQDTHAQRRLPVETAAPAALGASSTWKALAWLPLLEP

Peptide

MGLADVSCVGAR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page