top of page

CircRNA

Gene

chr19|3647409|3648624|—|1|ciRNA|PIP5K1C|NM_001195733|9

PIP5K1C

Open Reading Frame (ORF)

LQSHRWAPGSAAPQVGARVCSPTGGRLGLQSHRWMGAPRTPMHRGACPWKQPHQQLSGLPQPGKLLLGCPFLSPKGKVFGRLENLE

Peptide

LGLQSHRWMGAPR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page