top of page

CircRNA

Gene

chr19|3547573|3547847|-|1|ciRNA|MFSD12|ENST00000588918.5|4

MFSD12

Open Reading Frame (ORF)

LRPDAEHTWPLVQPTPRANVTHQVLLSSSWPTPLGSHYQWIKCQLQGAHPGPGAPCWWEWRRPS

Peptide

ANVTHQVLLSSSWPTPLGSHYQWIK

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page