top of page

CircRNA

Gene

chr19|3522955|3534513|+|12|circRNA|FZR1|ENST00000441788.6|2,3,4,5,6,7,8,9,10,11,12,13

FZR1

CircRNA UID

circFZR1(2,3,4,5,6,7,8,9,10,11,12,13)

Open Reading Frame (ORF)

MSPDGEAIVTGAGDETLRFWNVFSKTRSTKANLAAGRALPRHGPGL

Peptide

ANLAAGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page