top of page

CircRNA

Gene

chr19|3193283|3201626|+|4|circRNA|NCLN|ENST00000590671.5|3,4,5,6

NCLN

CircRNA UID

circNCLN(3,4,5,6)

Open Reading Frame (ORF)

LCCWSWHASSPGSTPTSARTPPIHGDRAGDAGHGDRRPRVLCRGGRGPAVYLQADPGCLRLPGLRLCC

Peptide

AGDAGHGDRRPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page