top of page

CircRNA

Gene

chr19|19120764|19121166|—|2|circRNA|TMEM161A|ENST00000450333.6|9,8

TMEM161A

Open Reading Frame (ORF)

LVAGGAVPAAAGGDPAPPAGLPVPGQGPGGAAAKGGWPHRSP

Peptide

GGWPHRSP

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page