top of page

CircRNA

Gene

chr19|19042710|19052195|+|3|circRNA|ARMC6|ENST00000392335.6|2,3,4

ARMC6

CircRNA UID

circARMC6(2,3,4)

Open Reading Frame (ORF)

LWPALAPRRCQHTSPASATSANRTRPAASSRPRRGPTPSSSLPGSWPLQVTRAFCSSPSMPCRC

Peptide

GPTPSSSLPGSWPLQVTR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page