top of page

CircRNA

Gene

chr19|19009854|19031082|-|4|circRNA|SUGP2|ENST00000452918.6|5,4,3,2

SUGP2

Open Reading Frame (ORF)

LKHLRPLLPAHLLTGKITWQPDELHRRLLMLYYKKKPNDITWMPVVRL

Peptide

ITWQPDELHRR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page