top of page

CircRNA

Gene

chr19|19001612|19004646|—|2|circRNA|SUGP2|ENST00000452918.6|8,7

SUGP2

Open Reading Frame (ORF)

MTKIVLLSNSIERKCLNYVHQFVSRHLRTTFTLVVVTPRVLRRAPWTSWKGKQSLKTSPLRGRLSWRAQR

Peptide

HLRTTFTLVVVTPR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page