top of page

CircRNA

Gene

chr19|18537600|18538433|-|2|circRNA|FKBP8|NM_001308373|6,5

FKBP8

CircRNA UID

circFKBP8(6,5)

Open Reading Frame (ORF)

MTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKEPIHPPARGPVPGGDPEDGCGRA

Peptide

GKEPIHPPAR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page