top of page

CircRNA

Gene

chr19|17807757|17808374|+|1|circRNA|B3GNT3|ENST00000599265.5|2

B3GNT3

Open Reading Frame (ORF)

MCAASCCGARGAASARYGVCSCASSSWWAQPPTRTRPARSTGCWSWRHRLTETSCSGTSTTPSSTSRSSRSRPGGSSGRPQTLAGQDEVSPAPAAQCHPHSGHRRFHPPPLQSASVTTHLQGPGAATGDPRGPGLAHSTHPPSPGPVPCQHLYGHPPGLRHAAAARSELPPVQTLPPLSPAAGRAPL

Peptide

GPGLAHSTHPPSPGPVPCQHLYGHPPGLR

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

29

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page