top of page

CircRNA

Gene

chr19|16647095|16654125|—|2|circRNA|CTC—429P9.4|ENST00000594509.5|5,4

CTC-429P9.4

Open Reading Frame (ORF)

MKPGTHFPGMPSLHSSIPDDFKNVFDQKTDNLPRKSKLVVGGKVFAEVTTSGNSC

Peptide

MKPGTHFPGMPSLHSSIPDDFKNVFDQK

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

28

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page