top of page

CircRNA

Gene

chr19|16577680|16578334|-|1|ciRNA|CTD-3222D19.2|ENST00000409035.1|3

CTD-3222D19.2

CircRNA UID

ciCTD-3222D19.2(3)

Open Reading Frame (ORF)

LGASVSLLRRTKRGGVPSQLVPRDLALPRALQRPSGVTPILHAQHTSWARGDIRRGVLGGGSSERHHPQPST

Peptide

LGASVSLLRR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page