top of page

CircRNA

Gene

chr19|15927543|15929456|—|1|ciRNA|CYP4F11|ENST00000326742.12|2

CYP4F11

Open Reading Frame (ORF)

MLCYCSTLSLQPGLVSPSSTILPSSSTLGLLPAMLGGMRGSAHPWLGAFLRTRAELVVVGAGKHQRPSSLSPPQASVWPLQGPGPSSCFSLSHVPLSFMYSRTPHVSVSSLHCHLSLPLCSGHHWGSKKPQFRALSSRKPRA

Peptide

GSAHPWLGAFLRTR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page