top of page

CircRNA

Gene

chr19|14039507|14039910|+|2|circRNA|IL27RA|NM_004843|3,4

IL27RA

CircRNA UID

circIL27RA(3,4)

Open Reading Frame (ORF)

LPVPLPKMSGGGLDPAVPTKPRLWQWQPDGAGWPFLGNSSPCLTNSLSGALRQASLSGPPSS

Peptide

MSGGGLDPAVPTKPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page