top of page

CircRNA

Gene

chr19|1270927|1274440|+|6|circRNA|CIRBP|ENST00000585913.5|2,3,4,5,6,7

CIRBP

CircRNA UID

circCIRBP(2,3,4,5,6,7)

Open Reading Frame (ORF)

LKGPGQDSGKGGLRAAMTSGVTVPGGTSPGTRAGGSRLPRRLVPCRHGIR

Peptide

GPGQDSGKGGLR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page