top of page

CircRNA

Gene

chr19|11113277|11113762|+|2|circRNA|LDLR|ENST00000558518.5|9,10

LDLR

CircRNA UID

circLDLR(9,10)

Open Reading Frame (ORF)

LAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGLHRLPLLHQPARGQEDDAGPERVHQPHPQPEERGRSGHGGGQQ

Peptide

GQEDDAGPER

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

true

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page