top of page

CircRNA

Gene

chr19|11100222|11102786|+|2|circRNA|LDLR|ENST00000558518.5|2,3

LDLR

Open Reading Frame (ORF)

LQIRGLQLWGPCQPLHSSVLEVRWPSGLRQRLRRARLSGRQMRKKRVPVPRREMHLLQVGLRWQR

Peptide

EMHLLQVGLRWQR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page