top of page

CircRNA

Gene

chr19|10361510|10362657|—|5|circRNA|TYK2|NM_003331|14,13,12,11,10

TYK2

Open Reading Frame (ORF)

MSQVSHTHLAFVHGVCVRGPERSHLCRPSCGPRTACTSFTGAPATPTA

Peptide

GPERSHLCRPSCGPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page