top of page

CircRNA

Gene

chr18|9208656|9221999|+|4|circRNA|ANKRD12|NM_001083625|4,5,6,7

ANKRD12

CircRNA UID

circANKRD12(4,5,6,7)

Open Reading Frame (ORF)

LMMMKVTQRKKVQKRRRQKRKLEIRNPHQLAFFLVIHSLSENRWHFLCR

Peptide

LMMMKVTQR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page