top of page

CircRNA

Gene

chr18|7926567|7955414|+|3|circRNA|PTPRM|ENST00000580170.5|5,6,7

PTPRM

CircRNA UID

circPTPRM(5,6,7)

Open Reading Frame (ORF)

MGMGPLWPERWSTARPVGAGMTGSQSIPRAIKLDTLTQIQNMRLVCS

Peptide

MGMGPLWPERWSTARPVGAGMTGSQSIPR

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

29

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page