top of page

CircRNA

Gene

chr18|70047970|70109717|—|13|circRNA|RTTN|ENST00000255674.10|40,39,38,37,36,35,34,33,32,31,30,29,28

RTTN

Open Reading Frame (ORF)

MRLISMACRPLSGPYEGWLTSLRFRDGAHTLLSQSL

Peptide

MRLISMACRPLSGPYEGWLTSLR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page