top of page

CircRNA

Gene

chr18|62157128|62162329|-|4|circRNA|PIGN|ENST00000357637.9|6,5,4,3

PIGN

Open Reading Frame (ORF)

LILFLMKVNTHGAGEAQISCLCLPKRFTNNSKLHTGLESTPMFRLILAI

Peptide

VNTHGAGEAQISCLCLPK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page