top of page

CircRNA

Gene

chr18|58918270|58920633|+|1|circRNA|ZNF532|ENST00000336078.8|4

ZNF532

Open Reading Frame (ORF)

LLPLSRVPAAPSLKLPTPSSSKLSWCRHPAWPMPNSCQRLCTLPTLTFCLRVPRPPLNSAKC

Peptide

HPAWPMPNSCQRLCTLPTLTFCLR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page